DPCstruct | MC33929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2JMM7 | 1-69 | MSRLPAPYGDCVPDGKTSDYIYSSYEYSVEGCYRSCFQQLVLKECRCGDPRFPVPENARHCDAADPVAS |
| A0A6P4VFL6 | 33-107 | LERKGEPYSQCTMNGSDVPVRNLYSDYNTTYSIQACIRSCFQDHMIRNCSCGHYLYPLPRGQRYCNNREFPDWGE |
| F1L2M7 | 6-78 | None |
| A0A1Y3ELX9 | 291-354 | None |
| A0A158PML8 | 254-323 | None |
| A0A0B1SJW2 | 203-272 | None |
| A0A3P7KVZ9 | 25-94 | None |
| A0A7E4V225 | 495-568 | None |
| A0A0C2DBL7 | 1-75 | None |
| A0A0C2BPD7 | 59-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.