DPCstruct | MC33925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 137 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EIF0 | 8-120 | CRRLSQRPTAQELEEKHILLRQTPEEIQKDREEIKKTLIRKLSFRPTVGELKERRIIKFNDYVEVTDVEEYDRRADKPWTRLTPRDK… |
| A0A3P8VNA4 | 20-145 | IQLFSLAFLFRRLSQRPTAEELEQRNILKPRNEQEEMEEKREIKRRLTRKLSQRPTVEELRQAKILIRFSDYVEVSDAQDYDRRADK… |
| A0A818EN50 | 740-874 | None |
| A0A4Z2DJ60 | 575-707 | None |
| A0A812DPM7 | 992-1140 | None |
| I3NFQ8 | 11-131 | None |
| A0A7M5XAE8 | 307-456 | None |
| A0A0B1TFP2 | 186-325 | None |
| A0A4Z2EI53 | 3-133 | None |
| A0A803KDX9 | 519-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.