DPCstruct | MC33924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154P425 | 262-364 | TWRGSPEMTNLRRGITAPRYNTYYYVLISLIGLLLQTQYATGGMCWSSISNGRCKELLAQGVTKDNCCASNSAATTAYSEDDLNSGA… |
| A0A5C6N0U0 | 1-93 | MFGMLKHHLHPGILLLFMWLCHLMEHQKVQAGNCWLQQGKNGRCQVLYMPGMSREECCRSGRLGTSWTEEDVPNSTLFRWMIFNGGA… |
| A0A1I8N2X3 | 318-425 | None |
| A0A4W3HZ41 | 1-133 | None |
| A0A6J1P9U6 | 65-178 | None |
| A0A6P5V0B5 | 119-235 | None |
| A0A151IU44 | 29-138 | None |
| A0A6J2SWZ2 | 228-332 | None |
| A0A7R9H1I9 | 113-208 | None |
| A0A3B1KM55 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.