DPCstruct | MC3392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 233 ± 50 aa |
| Standard deviation of domain lengths | 49.63 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF04790- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3J1M0 | 35-260 | HGDGMGNLRVTKKGIRLEGISEFLLPLYVKEINSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTVGADAVEAQCKRFEVRSSEGGRV… |
| A0A4E9FBN5 | 1-159 | MSGYETSMLNMFQDGRMEAVCDRFEIYDNSRKLLFFAEPNEIGFKLENLRILDDGGSVFEGAIQTALIRPESDSPLSLESPTRSLNL… |
| A0A6F9CJJ7 | 21-246 | None |
| A0A2A2KF66 | 66-284 | None |
| T1KW66 | 46-311 | None |
| A0A7R8H995 | 68-308 | None |
| A0A7R9LWG4 | 1-191 | None |
| A0A1D2NEG4 | 102-374 | None |
| B4I9I0 | 158-331 | None |
| A0A1I8NEH9 | 532-796 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.