DPCstruct | MC33912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 262 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4DQJ5 | 1-290 | METQSQFWQKPYGSSDSNGYLGNEGPEKDSVYSRFAIVAWPAVDNVEFTMKFASLGTAFETLRVQRPVDTATLLKFMDLAITKLADI… |
| A0A6A3L6A2 | 85-348 | ESLSRLWDNTRKSTMPECDRFAIAMWPSSADIVNQVDLMGIAAAIPTILLHDALSDATVRMLLKNDVLGSYNFALAVQSSKSPIQLL… |
| A0A6A3MZT7 | 123-392 | None |
| A0A2P4YU32 | 1-234 | None |
| W2I5W0 | 405-657 | None |
| W2XGZ5 | 216-477 | None |
| A0A225WBD7 | 41-308 | None |
| A0A329T063 | 11-301 | None |
| A0A6A3YAQ4 | 3-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.