DPCstruct | MC3391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 184 ± 31 aa |
| Standard deviation of domain lengths | 31.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0SGT8 | 3-180 | AASLSHDFYNLSTIMFNEFDEKYAQGKLYYINVTKSCHTNSFHAPEEEDKAQQTNIEDLSKWTLVLLYSWNNPLHHLVTELQHMKEL… |
| U3IUJ9 | 151-353 | APPAVCAPGDSGCLRLSVADLFDRVIRHSGRIHSLSTALCAELENRFPARDNELGKPARRCPTAGMLTPNGKEYAQKIPREELTNVI… |
| A0A6P8GH09 | 60-296 | None |
| A0A2K6BPV2 | 1-199 | None |
| A0A2K6UKJ3 | 1-198 | None |
| A0A821ASR0 | 1-134 | None |
| A0A6P7D7X5 | 29-137 | None |
| F6WDB6 | 25-186 | None |
| A0A6J2UPR7 | 76-292 | None |
| A0A3B4ANI0 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.