DPCstruct | MC33907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 236 ± 29 aa |
| Standard deviation of domain lengths | 28.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4BK58 | 38-246 | DIYERLLRCPDMDSMNAIDSRLAKRLHSENDSAFAWWIAHEGSNYSIPKTPEGQRPWLALLDWMCEHPAAMHHVLAYLPFPEIAAQC… |
| A0A6A3VW38 | 2-208 | AYARILQAADVELLDSADRPLLVLLQTSNREAFVKWSNTHRELLCIPVTRKRRAEVSELHPWLMDNYVAMRHLHAYLPYAVLEIKSW… |
| A0A6A3LH53 | 171-389 | None |
| A0A6A3HMK3 | 308-516 | None |
| A0A6A4BG63 | 189-448 | None |
| A0A6A3HS17 | 274-490 | None |
| A0A6A4DM16 | 44-281 | None |
| A0A6G0QLB9 | 596-805 | None |
| A0A6A3V9C1 | 2-198 | None |
| A0A6A4CAW1 | 420-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.