DPCstruct | MC33902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9NVP7 | 1-120 | MGHGDEIVIADANFPGSSIGPDCIRADGSSASEVLQAILSVMPLDTFVPDPALSMQVVDDPGAVPEAVADFQRIIDETADNPASIQG… |
| A0A1Q8RAQ2 | 457-595 | VLKGISPVISPDLLKVLAEMGHGDEIVLADAHFPSHSICPPHIPVLRADGITVSRLLAGISPLLELDNYGVVPVIMMEVVKGDTADA… |
| A0A806JEY3 | 1-137 | None |
| A0A5B7CX04 | 106-229 | None |
| C1BMW8 | 1-88 | None |
| A0A7C5LNL7 | 61-204 | None |
| A0A6I9PRA1 | 1-135 | None |
| A0A3D4ZVW8 | 23-152 | None |
| A0A6I9JX63 | 8-132 | None |
| A0A354XQT9 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.