DPCstruct | MC33900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 200 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7L0F5 | 1-220 | MELSTKTRKKFGDDGGFWEDWYVTYTVHGQTCSLCLVRDYDKHDNLNKVSFILLDLGLGFRTLCLHIETTSETGFLRINSTQSIPWT… |
| V7C7H1 | 103-331 | IGNYSNTIKLGNAATISVKTAVNENIFSRKETWELSYLANRITSTLFIDKTTTKKISDEEKISISIRDFLPKGNLHYSTRAEAGFPP… |
| Q2HU10 | 25-215 | None |
| V7C3X6 | 33-235 | None |
| A0A445HJ80 | 5-167 | None |
| V7B0A6 | 1-204 | None |
| A0A0S3RIL9 | 18-205 | None |
| A0A2K3LNA3 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.