DPCstruct | MC339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2U5D6 | 1-90 | MAYRLKYRTKDRSTDYFFSFEQKGREWRAYIEWQPSYNNRATDAHSTHRRSDGNRKYVCWNHPLKSLEEAKKVAALWADNTQKYIRT… |
| N0BAA7 | 25-128 | EIIDFSLWAPDAYGEYSYTTRDRSCTFTFDLKRVGAVIRIYILHQPSYGRRATDGHSTHRIGVLTDHPYICIGDRYQPTTVPDALSW… |
| A0A1Y4NB51 | 3-133 | None |
| A0A2T7VYX7 | 18-114 | None |
| A0A2E8D3J3 | 19-127 | None |
| A0A374IIL4 | 44-146 | None |
| A0A7Z9KYJ1 | 13-107 | None |
| A0A517ZKC8 | 15-116 | None |
| A0A517ZK74 | 1-88 | None |
| A0A2N2YYN3 | 98-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.