DPCstruct | MC33886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 270 ± 56 aa |
| Standard deviation of domain lengths | 56.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5FL98 | 297-607 | VFGFLGVLTRYVLRKFFGPNILALTSDDSPLYLDLPSNILGSFLMGWFGIVFKADIRQISDHVVVGLTTGYLGSLTTFSGWNQEMLD… |
| E9B261 | 2-250 | GFSVTVLPPEAALPLTYRALCVGFCGSFTTCSSWIVKAMVQDTVAETFEHLFIGSAMPLVLFLWGRDCGCGVRWCGEHIIGSPCETW… |
| A0A066VU40 | 86-279 | None |
| A0A200QMK5 | 81-384 | None |
| U7PUX1 | 229-512 | None |
| A0A540MBQ6 | 131-314 | None |
| A0A4S4EJJ2 | 263-581 | None |
| S9UV04 | 10-252 | None |
| A0A7G2C463 | 46-335 | None |
| A0A4T0NJ03 | 547-828 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.