DPCstruct | MC33882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 196 ± 24 aa |
| Standard deviation of domain lengths | 23.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 57.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819ERJ5 | 46-270 | ISNYNELQGLFLLFAQLNDIKLVMNKIESTDQLWINLFKDINNSSTIENILNIGLHDEIFLIPQIAIIIDELIEKGKEDSISIIFPY… |
| A0A817LNH7 | 1-228 | MGKYSLFLLCAQLDDTKLLINKIECIDQLWINLFKENNNNQSYIEEILNTSLHNETILTPQVALIVDELIQQGKEDIISILFPYIIK… |
| A0A822ABZ9 | 66-224 | None |
| A0A816HH56 | 82-265 | None |
| A0A820IGT8 | 1-222 | None |
| A0A820HGH2 | 462-665 | None |
| A0A816DHB8 | 654-846 | None |
| A0A818PPQ4 | 659-828 | None |
| A0A819X5R1 | 14-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.