DPCstruct | MC33881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 206 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821YCM2 | 125-328 | SVLIYLIQRMHPSKKEKESPFRIFLRLSNNLKLNSSMFFEQFQSIFSNGIKIQRYEMKDIIELFAWIRLQDQLFDQYFSHYSFTVNT… |
| A0A817KLL3 | 1-226 | MPAFIYMIQKFHPLKPYPRSPFMIFVQLQKNLEIDDIDSFLKHFLPIFESGVKEDRYQMQYVADFIRSMGRRDHTIDNYLSIYSLHV… |
| A0A815WJ15 | 1-187 | None |
| A0A816GJT0 | 1-202 | None |
| A0A814HPA7 | 52-255 | None |
| A0A819Q194 | 52-252 | None |
| A0A820D654 | 227-432 | None |
| A0A816YM16 | 161-414 | None |
| A0A815NTI7 | 1-167 | None |
| A0A821K2N3 | 1-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.