DPCstruct | MC3388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 175 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5SJ69 | 19-201 | DIRTITMGISLLDCIDADIDKAAEKIYQKIVKKAGKLVEVGNEIGHELGIKIVNKRVSVTPIAIIGAATAADDYTPLALAMDRAAKE… |
| A0A378QY57 | 14-200 | KVRTVTAFICLSDDKNDWENILNVAKLNCQKVANQLMEHGYIVQSLRLVTNPFGEYINTDNFDFAKQDLSDLTNILNKLNQDNPLRL… |
| A0A7S0HH72 | 3-179 | None |
| A9UQJ6 | 875-1027 | None |
| H1D581 | 2-168 | None |
| W5IGJ3 | 22-144 | None |
| A0A7Y2EAR2 | 25-196 | None |
| A0A378N7Q6 | 10-193 | None |
| R7QQ58 | 8-188 | None |
| A0A7C5YWS2 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.