DPCstruct | MC3387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 556 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Standard deviation of domain lengths | 22.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 11.32 |
| Pfam Score | 22.92 |
| Assigned Pfam label(s) | PF18393- PF11320- CL0159- PF06674- PF11319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553GAG0 | 83-249 | VFLDSMLQVKEMELVPLMKNFTESSDYGTKKILIHKRQKPENSYGRIYLRAHLNLEGDFYISSRYTGTERIHHDQIKVYFNKNSVLS… |
| A0A7D4T1Z2 | 11-190 | IISSLFLGLVVIFDAAAQEGVSKQLGDYHLTLYPDIQGDVLDLEAFTKQSDQEVFFGVTCSAMSPFPSMQVLLFEDEIISEFPRLMK… |
| A0A2D6QSA1 | 82-247 | None |
| A0A3G4XAX7 | 8-155 | None |
| A0A5M8P5X6 | 1-138 | None |
| A0A1Y6EKJ5 | 23-191 | None |
| A0A1Y6FH71 | 55-220 | None |
| A0A7W9A202 | 18-163 | None |
| A0A849E9K8 | 32-226 | None |
| A0A850Q823 | 109-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.