DPCstruct | MC33867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 24.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328BUM1 | 511-680 | KFTGTLNPDYIRRHWDELLRLAGSIKSGRVTASLFIRKLQAYPRQNHLTYVLQAYGQLIKTNFILRYLQSQPLRRRIHAQLNKGEEL… |
| A0A7X9RLS9 | 17-158 | ELTKALQRNGQPTELGKAIIEYGKVYKTKHQLRYISDEIYARQILEQLNKGKARHTLCRHIFYGKKGKLYQTYIDGMEEQLTVLSIV… |
| A0A6C0NDI8 | 243-398 | None |
| A0A1V4VHX2 | 61-188 | None |
| A0A0F5MPB7 | 2-168 | None |
| A0A3A0GB90 | 46-217 | None |
| A0A0D7X0S4 | 1-161 | None |
| A0A0J7XHC8 | 15-142 | None |
| A0A102EQC7 | 156-301 | None |
| A0A1A9GFD7 | 28-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.