DPCstruct | MC33865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 103 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 20.00 |
| Assigned Pfam label(s) | PF08555- CL0228- CL0016- PF12807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5Y435 | 77-154 | GLTALTGTLTFTNGSAAVTGTSTLFTSELAAGDWVQLDADGELYRVESITSDTAMTLERLYAGTGGTGAGSAISPLET |
| A0A4U9VB78 | 1-104 | MWYKTGTINLTANNATVTGTGTAWADTKFGVMPGMILLAPDNKLYEVKQVNSNTSLTLNSNYAGTTASGQSYAIITTYEGDISQFSA… |
| A0A560FGF0 | 1-110 | None |
| A0A3N1XEL1 | 3-92 | None |
| A0A1B0A2R8 | 440-564 | None |
| A0A7C3YRA7 | 277-355 | None |
| A0A0V0QQ83 | 11-146 | None |
| A0A6G0ZX21 | 5-116 | None |
| A0A510XT88 | 2-100 | None |
| A0A228QXJ9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.