DPCstruct | MC33864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 15.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9V3I6 | 1-139 | MAQQIKRGDRSRRDDDRYLFLEAILSAQQQLYISFIGRSIQDNSERYPSVLVTELLEYLQQSYCLPGDEGLDADGSARRVGEHLLKR… |
| A0A377DNW5 | 23-144 | KRGDRSRRDDDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHLTCLHTRMP… |
| A0A4U9D6H6 | 53-212 | None |
| A0A379WLZ7 | 1-138 | None |
| A0A661TCP5 | 209-326 | None |
| A0A090QWX5 | 131-262 | None |
| A0A379B950 | 113-253 | None |
| A0A4U9IHI4 | 234-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.