DPCstruct | MC33862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1J095 | 111-175 | RNQLDLEKSVSENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLAKLL |
| A0A4U9V0K9 | 3-78 | PSWKWLTLTSTRAELDPERTVMDNLAEGKQEVMVNGRSRHVLGYLQDFLFHPKRAMTPVKALSGGERNRLLLAKII |
| A0A379WCJ7 | 1-61 | None |
| A0A2V8IKY4 | 721-791 | None |
| A0A377CY06 | 8-72 | None |
| A0A377XAM7 | 1-57 | None |
| A0A6L5D8Y4 | 101-169 | None |
| A0A7J6ZC53 | 853-914 | None |
| A0A6L5IHY0 | 1-76 | None |
| A0A813AFW7 | 855-924 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.