DPCstruct | MC3386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482URM7 | 5-92 | TKASKSKAEKAQKKRVLEELKALALECVPEDLRQDLIIDVNEVVCGDPSCAPIDTFVQFVWASSGKGMFAIPEAAANIPKEDFVQNFP |
| A0A2E4H146 | 6-79 | KKQNADHTNRVKALVRDIWGIDEGVVIMVSELKCYEDGCPELETVVVLMDEGAQPKTIKINKCLSEIDVKTISS |
| A0A4Y3WFH9 | 167-234 | None |
| A0A7R9UKI7 | 12-116 | None |
| A0A4V3DYS0 | 15-99 | None |
| A0A7R9T1G5 | 2-101 | None |
| R1CRH7 | 6-106 | None |
| A0A1M5TZX4 | 9-89 | None |
| A0A6J4GZX1 | 7-76 | None |
| A0A4R3BRV2 | 136-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.