DPCstruct | MC33856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 162 ± 41 aa |
| Standard deviation of domain lengths | 41.28 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0392- PF12339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5XVC5 | 224-390 | LTTEHELLRRLEAAGHPELDRRRLADPLGLFRTHFLLFHCLYRLRERLAAAGEASLEIHCLRIRLGPPQGRGATLPDGHDPLRDFYL… |
| A0A240EQN7 | 2-154 | PSFDDSPEKDLFKRNFLLMNALFQLQELLLPEQWLQVEAMDIQLLPYNPREHQIIDSDPLREYYLDWSHYEAEVGEVRRLLEDFWQR… |
| A0A7V2JR04 | 2-137 | None |
| A0A7C1GXL0 | 1-103 | None |
| A0A411Z9B1 | 1-97 | None |
| A0A524PSB9 | 43-251 | None |
| A0A655VF17 | 10-115 | None |
| A0A509DXU0 | 113-273 | None |
| A0A1G5PKM9 | 27-190 | None |
| A0A847LS22 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.