DPCstruct | MC33855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 18.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A240EM36 | 2-124 | YKLPEHEKVSATKVVKLYAQRMQIEEAFRDTKNSKLGLGLEYANSKSAKRYDNLILIASLITFMLWCVGFVSAQLTQSRLLQANTER… |
| Q6LNM0 | 280-397 | NANIAVSLYRQRMQIEENFRDTKNGKLGISLEYANSKSVERFDNLLLIAGLILFIIWCVGRAAVMKKIHYSLQANSLKYRAVLSTIY… |
| A0A811W3C1 | 665-826 | None |
| A0A2X7FHA6 | 3-105 | None |
| A0A7C3JLZ8 | 111-232 | None |
| A0A3D2CU95 | 3-104 | None |
| A0A377LSB9 | 15-138 | None |
| A0A1C0TXT3 | 18-124 | None |
| A0A2E9VPP0 | 1-118 | None |
| K6YP63 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.