DPCstruct | MC33854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2YWG7 | 543-640 | RGKEVHLINYPPTDLANLNFFGTWEDNSNLSQGKYYRSLNGLPWAINITEPFEWPREKIEIGWAYFHFIEWAQSSGATYPDWYKNYP… |
| A0A2E5EUY7 | 3-78 | LFGTQNDAADPQTPTSLYKTNLGHPWGIHTADSRYQMPAEEVDVTKVYIDFATWAESGGTEKADWYIRPDSNFLLV |
| A0A829D404 | 1-84 | None |
| A0A4R0MK80 | 406-510 | None |
| A0A642PT82 | 18-106 | None |
| A0A6H0KIF2 | 138-228 | None |
| A0A2N2Z5S3 | 275-365 | None |
| Q1ZTF7 | 590-711 | None |
| A0A656SET6 | 132-229 | None |
| A0A1D8S0E9 | 991-1086 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.