DPCstruct | MC33851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 234 |
|---|---|
| Mean domain length (aa) | 198 ± 37 aa |
| Standard deviation of domain lengths | 36.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 52.22 |
| Assigned Pfam label(s) | PF05662- PF13884- PF05658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5SHW8 | 9-216 | NTFIGYGAGTTTNSSEYNTFIGFNAGTLTTSGSWNCFVGARSGQANTTGYSNNFIGYVAGQSNTTGFCNSFYGPFKWVENTTGQHNT… |
| A0A5C7JP85 | 169-340 | QYNTGGYSNGFGYNTLQYNTGANSNGFGYVSLMYNTGDNSNGFGHYALRYNTGNNSNGFGYMSLMYNTGDGSNGIGYNALIYNTGNN… |
| A0A6J4GPP3 | 275-476 | None |
| A0A1Q7FM29 | 39-244 | None |
| A0A1Q7FI26 | 53-259 | None |
| A0A7C4P0U8 | 661-833 | None |
| A0A380ZTW2 | 334-496 | None |
| A0A838Z4Y1 | 19-228 | None |
| A0A838YKT4 | 287-510 | None |
| A0A1W9SU00 | 60-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.