DPCstruct | MC33850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9MK19 | 1-84 | MLLNLHVSTLSGAAIKFPSGEFNLPDSYAKMLFRMSSLLPSNLVNFAQGKGYSVSSESRGFMFNAEAAEIADFFEIGTRAAQLR |
| A0A7D5N9U4 | 1-87 | MRTNYGLVSILNIHISTRAGDKLLFPSEVNTGDKFERLLFEMSTPLDENMIRIAQQKGYDIRHNAKGYVFNGNATDLINFLNIGTPQ |
| A0A060R664 | 191-276 | None |
| A0A7V8ALF1 | 87-169 | None |
| A0A7U1HTW1 | 8-79 | None |
| A0A2P7TA70 | 226-315 | None |
| A0A7X7WAJ4 | 423-493 | None |
| A0A5C6Y7U3 | 156-242 | None |
| A0A6M5YLP4 | 610-692 | None |
| A0A177QUW8 | 60-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.