DPCstruct | MC3385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S8IQG3 | 6-100 | ELDRLIQGRNLDDLIAEFRAKTTGQHSPELQRLINRIRSEPMTGKLALLCTRPHEEWRLVRMNGRGKPMTLLDSVFHNLDDAEWAIF… |
| A0A2E4BRH6 | 10-98 | KHRHLVDEFRANPVGIHSPELQKVLNVFRGADMADKYVLVCVKPHKEWMLAQLGQGRGDPLTLHQDRVFHSIEEAEWEIFKIRWEYY… |
| A0A7W7G997 | 12-116 | None |
| F3KBZ1 | 1-73 | None |
| A0A172UW41 | 2-84 | None |
| C5AGS5 | 5-100 | None |
| A0A4R9PMF4 | 15-107 | None |
| K2BFW6 | 134-229 | None |
| A0A520W1U4 | 30-120 | None |
| A0A1I5HK83 | 17-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.