DPCstruct | MC33848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 332 ± 70 aa |
| Standard deviation of domain lengths | 69.77 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2UBL8 | 111-409 | MALNATAIDYVNANRADAADKFVAVGASLGGLTLRKALVDAPNHDVDTWISFDAPHEGANIPLGLQEYLEFFGPQDDAAAEMLAALD… |
| A0A2M7ND45 | 1-490 | MGGVISRYALADMEQRGIDHDTYLYVSHDAPHQGANIPLGIVALARHAVDKFVATPIGGTNINPTDGGNISTKTLRALIEAPGTRQM… |
| A0A7Y4T511 | 54-424 | None |
| A0A2H0ISP6 | 255-706 | None |
| A0A180F0Q4 | 349-660 | None |
| A0A221W5N4 | 152-396 | None |
| A0A1C3YD59 | 290-646 | None |
| A0A2D7DFU8 | 335-595 | None |
| A0A5C6RGZ6 | 152-475 | None |
| A0A1L7FBA0 | 1-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.