DPCstruct | MC33845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1WQS8 | 246-387 | KPLKALNATLSEHNLDLFYQAVDVSLSECGMILKKVDKKKDKLLIQNHREKLISELEICDDPALVLHLAVLAIYTIITQNMLHASGR… |
| A0A7S0WTS5 | 16-165 | AALAQASGALGAESLAEVASVIEAAASDMGLRVRRLDKKSEKAAVASERSRLLGSLSGESDPAAALALVVPLVFMKATGHALALPGK… |
| A0A8B6DHE2 | 1-126 | None |
| A0A7J7JAF1 | 15-175 | None |
| S9WKJ5 | 130-270 | None |
| A0A7R9DHT2 | 20-156 | None |
| T1FQH7 | 711-872 | None |
| A0A6V7W431 | 2-146 | None |
| A0A0D2MD11 | 884-1059 | None |
| A0A1S3Y2E1 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.