DPCstruct | MC33844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0WKJ9 | 2-87 | ELGGCSALQVLSLERNLIDAVPPAVLTGATSLWCLALGSNPLSADKLRVTEGYDAFDARRRAKVDKQIGGGTLVSSARRGLNEGAD |
| A0A1Y1I8V7 | 194-276 | PANELSALPDELSDATELRTLDLDGNPLSKLPSDLLRGCGKLHTLSAHGTSIRVEDLEKLEGYAAFEARRQGKYTKQLAGNAM |
| A0A5J5BIR9 | 160-242 | None |
| A0A1U8NUN9 | 213-295 | None |
| K8EKF4 | 316-407 | None |
| A0A5N5FZY6 | 38-132 | None |
| D8TND7 | 191-275 | None |
| A0A7G2EE67 | 722-802 | None |
| A0A059LEJ5 | 42-144 | None |
| A0A438KNP6 | 6-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.