DPCstruct | MC33841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XD28 | 2-51 | NVLKACSEAKVKRVVMVSSVAAVMTNPSWPEGKPMDEDCWSDVDYCRTTE |
| A0A287RSJ1 | 3-62 | PAVKGTLNILEVCSSLKVQKVVVVSSTAAVHSNPNWPQGKPKDESCWSDRKICMEKEVSK |
| K3Y237 | 1-66 | None |
| A0A6G1DDQ7 | 41-104 | None |
| A0A6P8ECY7 | 4-66 | None |
| A0A445BQH0 | 106-165 | None |
| A0A287QH00 | 5-67 | None |
| A0A6G1EX99 | 23-84 | None |
| A0A287RSU9 | 94-157 | None |
| A0A6N2KAD3 | 124-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.