DPCstruct | MC33840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 238 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 96.24 |
| Assigned Pfam label(s) | PF00082- CL0570- PF00958- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287RR97 | 16-98 | DYEHWLIVMDKPGGEGASKHQMIDCYIQTLAKVLGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGIPGVLFMLPDSYVD |
| A0A6A3ARF0 | 2-82 | VRTYEKICAQGLGISVDEAKKRIYACSTSTYEGFQVLMSEEESEKFNDVPGVVFVLPDSYIDPVNKEYGGDKYENGVITQR |
| M7Y800 | 4-112 | None |
| A0A396ICS0 | 1-96 | None |
| A0A5B6VX62 | 12-118 | None |
| A0A445D965 | 56-161 | None |
| A0A6D2HVE9 | 68-192 | None |
| A0A803Q4W1 | 340-450 | None |
| A0A2G3D4V0 | 109-192 | None |
| A0A7N2KM15 | 560-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.