DPCstruct | MC3384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0A5H5 | 4-151 | EQFAALSQVLTGYGQEAILPKLDTQHQAAEYLATLYTPGLVPVATLQLLTDTWNTISAMPQPTYEMQVKEQIMGNTELAPVAKNIIY… |
| A0A2V5NCI5 | 46-188 | VSLDQFVSLSSALTGVNAAQLKPALDPIGIANQYLAMINSQASKVSSTTFSALVSTFEAQVGTLGSPNKAAAFVLDDPTLGPVARSI… |
| X6GTT0 | 2-125 | None |
| A0A177RBM6 | 111-269 | None |
| A0A6G5RQC9 | 2-144 | None |
| A0A6L8DYX7 | 31-200 | None |
| A0A2M9L2X1 | 3-126 | None |
| M4ZRG9 | 9-144 | None |
| A0A0Q4K314 | 7-138 | None |
| I9WCM5 | 438-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.