DPCstruct | MC33839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 110 ± 24 aa |
| Standard deviation of domain lengths | 24.01 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 80.26 |
| Pfam Score | 82.40 |
| Assigned Pfam label(s) | PF16639- CL0304- PF03040- CL0127- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287RJX6 | 19-122 | SVSIMIYVITRTSISNAYPIFAQQGYETPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKKGGLN… |
| A0A7J8RGN7 | 2-80 | TGSIVCANCHLAKKPVNIEVPQVVLPDIVFEAIVRIPYDMQLKQVLANGKKRALNVGAVLILAEGFELAPPDRISPKMK |
| A0A7J8VE50 | 85-166 | None |
| A0A0E0GLC1 | 230-370 | None |
| A0A2G3D3C7 | 179-278 | None |
| A0A445DC37 | 8-94 | None |
| A0A1U8FRH4 | 224-360 | None |
| A0A396I4R7 | 30-114 | None |
| A0A6P6FNM4 | 189-320 | None |
| M7ZBD0 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.