DPCstruct | MC33838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453T3Y3 | 1-72 | TNRGAGSVVSGRGYREYRLGEYSTWLQRRVESAGNWAKIRSCLRDGGVCQRFGARGESLQQFVTNNLSPIQS |
| A0A287RIU7 | 1-92 | MFLLIVVLLGFTVFAFVVTHKGTGEAVSGRGFKEYRLGDYSTWLQRRLEDDKNWNRIKGCLQDAKVCKSLEDRKETLDQFMASDLSP… |
| M8AIT6 | 80-183 | None |
| A0A6P5Y4D9 | 78-182 | None |
| A0A4D6N2D1 | 471-575 | None |
| A0A2U1QE99 | 673-774 | None |
| A0A0B2QUB2 | 80-168 | None |
| A0A811M955 | 1-111 | None |
| A0A5J5QGZ0 | 2-106 | None |
| A0A5N6MMS9 | 245-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.