DPCstruct | MC33836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287RHR5 | 1-111 | YNVTFDHAAAAREVFERFHGCYDALRASGLPEAGLSALDIAGLPLYSVGHSNGALLQLLVGSYFSEKIPKANAIVSFNNRPASEAVP… |
| A0A6V7P9F4 | 17-119 | FASGFDHFLIADEVQFKFDRCLRFLQEIVTGLPTFGVGHSLGSVIHLLIGSRYAIQRSGNVLMAFNNKEASVAVPLFSPVIVPMAQS… |
| A0A5N6R4W8 | 157-255 | None |
| A0A438EX07 | 116-225 | None |
| A0A2J6KVF9 | 16-133 | None |
| A0A4S4DCQ3 | 178-299 | None |
| A0A2J6JNY3 | 16-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.