DPCstruct | MC33835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 231 |
|---|---|
| Mean domain length (aa) | 216 ± 42 aa |
| Standard deviation of domain lengths | 42.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | PF13976- CL0458- PF04998- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287RGZ1 | 2-223 | LILHGTKTSAVLNSVLADFFHLKRDHAVKFTKKNDSIRPFESGGETSLEFFSLKSDCSLLVYGSHSKKRPNNLVLGRTYDHHIYDLV… |
| E2ACN1 | 4-186 | LYDLKKPNAQMMQKKNDILPFENIVPIEKFAFKYEASLFMMASHNKKRPNNLVMGRMYDHMLLDMIEFGIENYKGLKDFKVEKVSLG… |
| A0A1N6LY28 | 7-267 | None |
| A0A0F7SN49 | 117-333 | None |
| A0A0P0VXB6 | 10-199 | None |
| A0A811MLG6 | 145-376 | None |
| A0A812QC86 | 590-827 | None |
| A0A1V9YWR4 | 73-284 | None |
| A0A2V0PL44 | 24-200 | None |
| H2C6L3 | 5-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.