DPCstruct | MC33831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 2 aa |
| Standard deviation of domain lengths | 1.92 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 79.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287R9N3 | 1-57 | MCGNVNWAKRTKCNVCNTSRPGHNEGGVRGGRGGGFKELDEEELEEVRRRRKEAEEV |
| A0A816IHA1 | 5-65 | PSFIHLCGNVNWAKRLKCNVCNTNKPGQNECGVRGGRGGGYKELDEQELEETKRRRREAEE |
| A0A453KKY5 | 67-128 | None |
| A0A816PSJ6 | 1-63 | None |
| A0A2J6K1N3 | 3-64 | None |
| A0A287R9G3 | 1-58 | None |
| A0A7J7CV84 | 106-166 | None |
| A0A804MQJ6 | 72-132 | None |
| A0A5C7HIL6 | 365-425 | None |
| A0A5N6R171 | 158-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.