DPCstruct | MC33830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 65.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A199VKA4 | 4-59 | GGIRVSIPAGVRRTIQNIKEIAGNHSDEEVYAMLKECSMDPNETAQKLLLQDTFHE |
| A0A287R892 | 1-58 | MAAARVSIPAAVRRTIQNIKEIAGNHTDEEVYAALRECDMDPNETAQKLLHQDPVSEY |
| A0A7J0EGC9 | 85-145 | None |
| A0A1D6PZU6 | 2-66 | None |
| A0A2Z6LPX8 | 1-55 | None |
| A0A0D3H4B9 | 1-57 | None |
| A0A4S4F2X2 | 2-67 | None |
| A0A835Q2H7 | 51-109 | None |
| A0A835QGN7 | 1-59 | None |
| K7LDS8 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.