DPCstruct | MC3383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522NAH7 | 199-288 | MMTTGPDAKLIYAYESADPVEALSFKVERIPMSDFVYPSYFEVFRKPGSTRFDRLGKVEKPFQILPGGYQIIFKNGKWTQVTGSAAK… |
| A0A7C3NU25 | 1-138 | MNLLVAGPHPANAKLDVFHWYEMCDAVQAETYEIDSVAVSNFVLPLYFTGSEEVGGRNDFLGRAHNGKTLRSFNVNPGGYVGFFNPQ… |
| A0A7I8EUF5 | 83-233 | None |
| A0A534HBQ2 | 127-263 | None |
| A0A318VG67 | 110-209 | None |
| A0A538PFR5 | 91-201 | None |
| A0A6C0K270 | 259-370 | None |
| A0A4Y9T6J2 | 120-222 | None |
| A0A2W5ZRX5 | 89-202 | None |
| A0A538PUQ4 | 91-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.