DPCstruct | MC33826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 79.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287QUG1 | 1-78 | MTPSAFIFLYENNLFLTFRNRTVAVWNFRGELVTSFEDHLLWHQDCSTNNIYITTDQDLIISYCKSDAASDDGTASPI |
| A0A287QUS0 | 1-82 | MTPSAFIFLYENNLFLTFRNRTVAVWNFRGELVTSFEDHLLWHQDCSTNNIYITTDQDLIISYCKSDAASDDGTASPIGSIN |
| A0A7J8YGL8 | 5-74 | None |
| A0A6A6LZW8 | 212-281 | None |
| A0A5N5MAS6 | 158-232 | None |
| A0A6P5Z9T5 | 576-645 | None |
| A0A4Y7LEP8 | 313-382 | None |
| A0A7J7I6J1 | 495-569 | None |
| A0A7S2G3I1 | 24-127 | None |
| A0A0K9PCP8 | 21-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.