DPCstruct | MC33825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 289 ± 43 aa |
| Standard deviation of domain lengths | 42.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287QT35 | 1-274 | SSSAPVASALPLADDLMEECIARLDIAMFNAILRESEDEIPTDPISDPITDPKVLPIPSGKFGFGAGVQLKNAIGSWSRCLTDLFGM… |
| A0A4D8YH45 | 255-521 | TRQEQGNFSVKLWKKAIKDASERICPVRGGGHDCGCLPILSKLIMEQLVARLDVAMFNAILRESADEIPTNPLADPITDANVLPVPP… |
| Q570M4 | 1-317 | None |
| A0A061SDA1 | 1-227 | None |
| A0A835Y3S7 | 560-916 | None |
| A0A2P2MQC1 | 117-449 | None |
| A0A6J0LZF9 | 70-389 | None |
| A0A087SNL8 | 112-385 | None |
| A8HZ49 | 26-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.