DPCstruct | MC33819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7FLL8 | 7-165 | MDAIKQQGKLLPEAKTIGQLYKKDPDQCEDDIVLILNDLRMFFQVDNIISNDGLYSVAYIIIHEYPSFTLEELAICMNQAKLGNYGK… |
| A0A0D8JC13 | 19-154 | LKQFNFDYCADRYRILNTQKAALVSKMINLRELTNVYNQETPRLLLSLWLTQLCLFMGFEAIEIQLRQTSEYMYEEIGMLNLAELTL… |
| J9G876 | 95-261 | None |
| A0A1M5IKL5 | 58-183 | None |
| A0A7T7V0X5 | 16-183 | None |
| A0A3N0WXU9 | 7-145 | None |
| A0A2S1LQT8 | 19-164 | None |
| A0A413UZV8 | 2-125 | None |
| A0A5N5Z5J2 | 20-181 | None |
| A0A840CUW2 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.