DPCstruct | MC33817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PAL4 | 20-103 | AELSDYQDASPRFDLFGYFEGRVDAWGMVQDRSGKQTRRFYVELNGSIEGNVLTLDEKFEFDDGEKSTRIWVITRLNDGTYEGS |
| A0A2N2IFK5 | 1-97 | MQPTLRLEEFFNGPVKLWGIVQDRSGNIVNRFDARIDGQWNEKNGVLDELFTYYDTGKQEKRIWKITKIDDLHYEGTAKDIIGTANG… |
| A0A7U6FXN1 | 28-111 | None |
| A0A520VHQ5 | 14-113 | None |
| A0A2V2A6A5 | 37-136 | None |
| A0A484Z0L0 | 9-107 | None |
| A0A0Q6SDN4 | 1-116 | None |
| A0A378EAS8 | 281-383 | None |
| A0A3N1LIE1 | 16-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.