DPCstruct | MC33814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HUW9 | 78-220 | CNHCVAACPHSAIRAKVVAPEEMENAPASLHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVE… |
| A0A5J4WYB2 | 1-139 | MQFSTLLRNCNGGIMTTATSRYEMRVILPFLLTHEESSKGLTQKFITKPDHDKEFKSSNFHIQVLQLGCIKYNIYDENCPAKAFSMV… |
| T0CNN9 | 239-349 | None |
| A0A2A5SUM6 | 231-363 | None |
| A0A842SPC5 | 396-533 | None |
| A0A2M6YGI6 | 693-826 | None |
| A0A2V9TPW7 | 209-351 | None |
| A0A6N8Q3B2 | 6-124 | None |
| R6HNS4 | 248-380 | None |
| A0A812XGL8 | 7-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.