DPCstruct | MC3381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 458 |
|---|---|
| Mean domain length (aa) | 193 ± 38 aa |
| Standard deviation of domain lengths | 38.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.76 |
| Pfam Score | 69.20 |
| Assigned Pfam label(s) | CL0169- PF20199- PF11726- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842HFI3 | 209-408 | YSALTKCKQRLPTYRNIRFLPWQAKMRRGTHLKFLEWWCNRHPFARMFVPTTGARCCVDELRERIQDLQRKTSKLNAKPWFKKHYEI… |
| A0A373FQJ8 | 7-177 | ATRALQIAQACEVYANAKGHQGVFLTLTLPSRYHAKRLEAGVMVGNPDHQHHLTPRKGHEELKRCWNAVRESMRRMGREAYGLRVVE… |
| A0A3E1NKP6 | 86-265 | None |
| A0A2N0DV75 | 141-366 | None |
| B0N7C9 | 78-245 | None |
| A0A1C6GAW9 | 1-215 | None |
| A0A3R8U0L2 | 12-198 | None |
| B8CP57 | 326-566 | None |
| A0A4Y4BDH8 | 31-211 | None |
| A0A837Q311 | 4-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.