DPCstruct | MC33806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661E3N3 | 6-93 | ISKTLLKKEMLALHKLGKKVVSLPDSQLKLMPLDEKLLDAVLAARKITKHGGLKRQLQYIGKLMRHVDPEPIREALLKIEEGQQQDSL |
| A0A7C5PTK5 | 96-186 | ETLPSKTRRKKDAEARQNLGIDLLGLPESDWRTLELPEELVLALREARHIRSNGARKRQFQYIGKLMRDIDPEPIRAHFEILRQRAR… |
| A0A3B8REF1 | 4-92 | None |
| A0A2M6XWP7 | 2-104 | None |
| A0A3S4HNX9 | 9-100 | None |
| A0A1Y4DI58 | 43-133 | None |
| A0A3D0SYV4 | 13-95 | None |
| A0A2E1TJ35 | 1-96 | None |
| A0A3A4RZ13 | 1-100 | None |
| A0A7R6QWF3 | 10-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.