DPCstruct | MC33803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X4ULJ9 | 50-148 | LLSSDTSNKQARFDAIKQAGYDIVVYAGDNLNDFGAATYHQDNAQRRAFVSDNQSKFGTEFIVLPNPLYGDWESGMARDYNKLTPEQ… |
| A0A516GTQ2 | 1-100 | MLLQTTTSNKDERRSSVLKTHEVVMYIGDNLGDFNSVFDHKPTSERHKITDSLKSKLGSTFIVLPNPMYGAWEYGLYNENPYGISEK… |
| A0A848Q9F6 | 78-155 | None |
| A0A380F393 | 3-83 | None |
| A0A3D5Y5A3 | 173-271 | None |
| A0A160FEL0 | 85-183 | None |
| A0A134C9M7 | 135-228 | None |
| U4VBK9 | 1-80 | None |
| X1X1W7 | 495-591 | None |
| A0A2W4SK25 | 5-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.