DPCstruct | MC3380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7KKU3 | 8-101 | SSSVTAFLDLLSQADAVMADSSPLLISWDVTEPTGSPSNELVRFSWEDGGLDYALVLTEEGIAAGRWQGDKYLCLDCEGDEVEISLN… |
| A0A373FD40 | 98-193 | KIQEFIDLLTRADSAEVSSSPLLTSWNTAPLTGEPDNEIIHFTWVDEDGSYSVTFTETGIENGKWVGGSFICIDSEGDENAIRLHRH… |
| A0A2R5F8C2 | 6-95 | None |
| A0A085FP87 | 181-277 | None |
| A0A1G5VRQ2 | 69-153 | None |
| A0A5M3Q3J5 | 125-230 | None |
| A0A5M3Q2G7 | 280-382 | None |
| A0A2M7MUW6 | 3-106 | None |
| A0A240UHT4 | 3-82 | None |
| A0A368X7Q9 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.