DPCstruct | MC33791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RNZ9 | 2-71 | AELELAEKEKMKDKVNKILQHNCNVFINRQLIYDYPEQLFAEKGVMAIEHADFEGVERLAQVLGGDIVST |
| A0A2T7C5M5 | 1-67 | MSKVADIEAAEKQKMSEKVQKIIAHGINYFVNRQLIYNFPEELFADAGILAIEHADFEGIERLVMAV |
| A0A2G2WNP9 | 663-734 | None |
| A0A4D6LGM7 | 885-964 | None |
| S9YC82 | 594-673 | None |
| A0A4S4DW50 | 107-175 | None |
| A0A183WMW1 | 241-308 | None |
| A0A183MAA4 | 147-213 | None |
| A0A366S0S5 | 256-327 | None |
| C4JUB6 | 258-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.