DPCstruct | MC3379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03230 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373FBB3 | 17-150 | QKVAEAKLFDFLPSMFGKYYLLGESVVYSTMRDLCSSYSGGHWEYFDLTNGGRFMRLSSDAELEVSVTGNYFQERISCEGACLIVNL… |
| A0A6L6F7B3 | 30-158 | NEQVRLKFLPSKLGRYCIAFENAIYNWMDRNAIAYNGGYWDFYTLSNGSFFLQPTKGYMITSPNGFMDDASAQEAGIIVTLMMLSHF… |
| V4NTJ2 | 230-357 | None |
| A0A1D8UXR7 | 7-110 | None |
| A0A6B9GFP9 | 9-127 | None |
| A0A427F962 | 2-138 | None |
| A0A811BQV6 | 111-262 | None |
| A0A6N8NN36 | 1-93 | None |
| D4C0X0 | 2-98 | None |
| A0A377A073 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.